- Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0060 membrane protein YE2027 (YE2027)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1072123
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 11,752 Da
- E Coli or Yeast
- 1-108
- UPF0060 membrane protein YE2027 (YE2027)
Sequence
MLKASLLFFVTALAEIIGCFLPYLWLRKGASMWLLLPAAASLALFVWLLTLHPAASGRVYAAYGGVYVATALIWLRVVDDVKLSLFDWVGAAVALVGMLIIVAGWRVN